General Information

  • ID:  hor006589
  • Uniprot ID:  Q7TNK8
  • Protein name:  Intermedin-short
  • Gene name:  Adm2
  • Organism:  Mus musculus (Mouse)
  • Family:  Adrenomedullin family
  • Source:  animal
  • Expression:  High expression detected in the submaxillary gland, kidney, stomach, and mesentery, followed by the pituitary, lung, pancreas, intestines, spleen, thymus and ovary. Expressed mainly in the intermediate lobe of the pituitary, with sporadic in the anterior
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0044877 protein-containing complex binding
  • GO BP:  GO:0001525 angiogenesis; GO:0003073 regulation of systemic arterial blood pressure; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007631 feeding behavior; GO:0010460 positive regulation of heart rate; GO:0010628 positive regulation of gene expression; GO:0045766 positive regulation of angiogenesis; GO:0045776 negative regulation of blood pressure
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VGCVLGTCQVQNLSHRLWQLVRPAGRRDSAPVDPSSPHSY
  • Length:  40
  • Propeptide:  MAQLLMVTVTLGCISLLYLLPGTLSGSLGKGLRHSRPREPPAKIPSSNLQPGHPSLQPVVWKSRRHAPQPQGRGNRALAMVHLPQGGGSRHPGPQRPTGSRRPHAQLLRVGCVLGTCQVQNLSHRLWQLVRPAGRRDSAPVDPSSPHSYG
  • Signal peptide:  MAQLLMVTVTLGCISLLYLLPGTLS
  • Modification:  T40 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Adrenomedullin-2]: May play a role as physiological regulators of gastrointestinal, cardiovascular bioactivities mediated by the CALCRL/RAMPs receptor complexes. Activates the cAMP-dependent pathway.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  3-8
  • Structure ID:  AF-Q7TNK8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006589_AF2.pdbhor006589_ESM.pdb

Physical Information

Mass: 508378 Formula: C189H301N61O56S2
Absent amino acids: EFIKM Common amino acids: SV
pI: 8.81 Basic residues: 6
Polar residues: 13 Hydrophobic residues: 12
Hydrophobicity: -37.75 Boman Index: -7820
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 80.25
Instability Index: 6102.25 Extinction Coefficient cystines: 7115
Absorbance 280nm: 182.44

Literature

  • PubMed ID:  14615490
  • Title:  Intermedin is a calcitonin/calcitonin gene-related peptide family peptide acting through the calcitonin receptor-like receptor/receptor activity-modifying protein receptor complexes.
  • PubMed ID:  14706825
  • Title:  Identification of novel adrenomedullin in mammals: a potent cardiovascular and renal regulator.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).